App LogoApp name
AR

Aakarsh Raaj

Open to work0 years experience

Full-stack Developer

KharagpurTarget Roles: Backend Engineer • Full-Stack Developer • Frontend Specialist

Full-stack Developer | B.Tech Student at IIT Kharagpur

GitHub

Standing Rank

Rank Not Available

Developer Badges

No badges earned yet

Skills & Technologies

36 skills
solidworksabaqussketchupstaad proms officefigmavs codematlabmongodbgitgithubngrokrest apiswindowsubunturedispub/subfirebasec++cjavascripttypescripthtmlcsstailwind csswebhooksreactexpress.jsnext.jsnode.jswebrtcwebsocketoauth2.0pythonreact nativeflask

Work Experience

Frontend Developer Intern

Phnex

May 2025 - Jul 2025 Remote
  • Developed responsive frontend components in React and Tailwind CSS for an AI-driven refurbished smartphone platform.
  • Explored integration of frontend workflows with REST APIs, webhooks, and real-time communication protocols.
  • Built proof-of-concept implementations using WebRTC and WebSocket for live device diagnostic and sensor-data streaming workflows.
  • Collaborated in an agile startup environment involving UI discussions, iterative development, and code reviews.

Projects

KDSH 2025 Onboarding Platform

ReactExpress.jsMongoDBGitHub API
  • Built a full-stack registration platform for KDSH 2025, handling 5000+ participant registrations using React, Express.js, and MongoDB.
  • Integrated GitHub APIs to enforce sponsor repository-star verification before successful event registration.
  • Optimized verification latency from ~50s to under 5s by redesigning the validation workflow from repository-stargazer pagination to user-starred repository checks under Vercel serverless execution limits.
  • Implemented parallel API request handling and backend validation pipelines, contributing to an increase in sponsor repository stars.

Crypto Connect

ReactExpress.jsMongoDBCoinGecko APIGemini API
  • Built a full-stack cryptocurrency tracking platform using React, Express.js, and MongoDB with real-time market data via the CoinGecko API.
  • Implemented JWT-based authentication, personalized watchlists, pagination, and dynamic coin-tracking workflows for authenticated users.
  • Integrated the Gemini API to develop a custom crypto-assistant chatbot capable of answering cryptocurrency-related queries.
  • Enhanced frontend experience using responsive UI design and particle-based animated backgrounds for interactive visualization

Naviq

Next.jsWebRTCWebSocket
  • Developed a Next.js based real-time communication platform with separate workflows for video calling and text-based chat sessions.
  • Implemented frontend integration for WebRTC-based peer-to-peer media streaming and WebSocket-based signalling and messaging.
  • Designed room creation and joining flows using sharable room codes with planned backend session management and concurrency control.

Jeevanhub

ReactNode.jsExpress.jsMongoDBJitsi MeetRazorpay API
  • Developed a full-stack Ayurvedic healthcare platform using React, Node.js, Express.js, and MongoDB with role-based workflows for patients, doctors, retailers, and administrators.
  • Automated consultation-to-purchase workflows by integrating prescription management, dynamic cart population, inventory-aware medicine handling, and structured diet/yoga plans.
  • Integrated Jitsi Meet for browser-based teleconsultations and Razorpay test APIs for end-to-end payment workflow simulation.
  • Deployed the platform under the official domain jeevanhub.com, configuring hosting and production-oriented backend services.

Leaderboard Standings

Leaderboard Position Pending

Global test scores, peer standing percentiles, and algorithm leaderboard ranks are updated dynamically.

Assessment Highlights

Assessments Not Completed

Coding evaluations, system assessment results, and conceptual score badges will appear here after taking a test.

AI Collaboration Score

AI Collaboration Score Pending

Developer coding behavior, assistant cooperation, and AI pair-programming indicators are evaluated during live coding sessions.

Role Compatibility Profile

Role Compatibility Analysis Pending

Custom matching reports, candidate role compatibility percentiles, and core engineer strength profiles are processed once conceptual code screenings are complete.

Achievements

Silver Medalist, Open IIT Case Study Competition 2023

Silver Medalist, Open IIT Case Study Competition 2023, for an extensive data-driven analysis of the cloud kitchen market.

JEE Mains 2022 Top 1%

Secured a rank among top 1% of a million students appeared in Joint Entrance Exam 2022 (Mains)

JEE Advanced 2022 Top 5%

Secured a rank among top 5% of more than 1 lakh students appeared in Joint Entrance Exam 2022 (Advanced)

About Details

Professional Bio

Full-stack developer and B.Tech student at IIT Kharagpur with experience in React, Node.js, and MongoDB. Passionate about building scalable web applications and real-time communication platforms.

B. Tech in Engineering

IIT Kharagpur (2022 - 2026)

Class XII

The Aryan International School, Varanasi ( - 2021)

Class X

The Aryan International School, Varanasi ( - 2019)

Languages: English, Hindi