App LogoApp name
AS

Archit srivastava

Open to work1 years experience

Frontend Developer

Gorakhpur, Uttar PradeshTarget Roles: Backend Engineer • Full-Stack Developer • Frontend Specialist

Full Stack AI Engineer & Frontend Developer

GitHub

Standing Rank

Rank Not Available

Developer Badges

No badges earned yet

Skills & Technologies

36 skills
pythonc++javascripttypescriptsqlhtmlcssreact.jsnext.jsangular 19tailwind csschakra uizustandtanstack querynode.jsexpress.jsfastapipostgresqlmongodbsqlalchemytypeormllm apisgroqgeminilangchainragpaddleocrprompt engineeringdockergitgithub actionsawspostmanvercelfirebasefigma

Work Experience

Full Stack AI Engineer Intern

Patronus

Jan 2026 - Apr 2026 Remote
  • Built an end-to-end AI-powered data extraction pipeline for 10+ universities across 10 academic years, autonomously parsing 500+ PDF documents and populating a PostgreSQL database with structured institutional KPIs.
  • Engineered a concurrent LLM extraction system using Python asyncio and Llama 3.3 70B (via Groq API), enabling 25 simultaneous API calls and cutting total processing time by over 60%.
  • Designed a multi-pass PDF parsing architecture combining pdfplumber deterministic table extraction with PaddleOCR for scanned documents, achieving significantly higher accuracy across 29 tracked KPIs.
  • Architected a SQLAlchemy ORM schema with full lineage tracking (university→document→page→chunk→metric) and implemented a 5-pass validation pipeline with cross-validation sanity checks.

Frontend Developer Intern

D2K Technologies

Jun 2024 - Oct 2025 Delhi, India
  • Developed the frontend for a FastAPI-powered data platform serving 1,000+ onboarded companies, building complex data visualizations with React.js and TanStack Query.
  • Engineered reusable UI component library with TypeScript and Chakra UI, implementing lazy loading and code splitting to reduce initial load time by 40%.
  • Revamped DhanLaxmi Bank’s LMS and Bank of Baroda’s LAB systems using Angular 19 and NgRx Signal Store, improving state management performance and system scalability.
  • Led a team of 3 interns, conducting weekly code reviews and enforcing linting standards, ensuring on-time delivery of production features across two client projects.

Projects

ChessNexus — AI RAG Chatbot

View Project
Next.jsLangChainAstra DBGemini API
  • Architected a context-aware chess assistant using Retrieval-Augmented Generation (RAG), leveraging Gemini API to deliver expert-level strategic insights with source-grounded responses.
  • Built a high-performance vector search pipeline with LangChain and DataStax Astra DB, indexing a domain-specific chess knowledge base with sub-second retrieval latency.
  • Developed a responsive UI with Next.js 14 and Tailwind CSS, featuring streaming markdown responses, Clerk authentication, and optimized prompt engineering for complex multi-turn queries.

Authentication & RBAC Microservice

View Project
TypeScriptExpress.jsTypeORMDocker
  • Architected a production-ready JWT authentication system with Bcrypt password hashing, refresh token rotation, and granular Role-Based Access Control (RBAC).
  • Achieved 90%+ test coverage with Jest unit and integration tests, ensuring zero critical security vulnerabilities across all auth flows.
  • Containerized with Docker and automated CI/CD via GitHub Actions, reducing deployment time by 30%; folder structure adopted as a template for future microservices.

Leaderboard Standings

Leaderboard Position Pending

Global test scores, peer standing percentiles, and algorithm leaderboard ranks are updated dynamically.

Assessment Highlights

Assessments Not Completed

Coding evaluations, system assessment results, and conceptual score badges will appear here after taking a test.

AI Collaboration Score

AI Collaboration Score Pending

Developer coding behavior, assistant cooperation, and AI pair-programming indicators are evaluated during live coding sessions.

Role Compatibility Profile

Role Compatibility Analysis Pending

Custom matching reports, candidate role compatibility percentiles, and core engineer strength profiles are processed once conceptual code screenings are complete.

Achievements

Achievements Not Earned

Special rewards, developer badges, system recognition certificates, and conceptual milestones will display here.

About Details

Professional Bio

Full Stack AI Engineer with experience in building data extraction pipelines and frontend development. Proficient in Python, React, TypeScript, and LLM integration. Passionate about scalable architecture and performance optimization.

Bachelor of Technology in Information Technology

Madan Mohan Malaviya University of Technology (2022 - 2026)

Languages: English, Hindi
Archit srivastava - Profile | Swiftcruit