App LogoApp name
MK

Mohith Kumar

Open to work0 years experience

Software Engineer

RemoteTarget Roles: Backend Engineer • Full-Stack Developer • Frontend Specialist

Computer Science undergraduate with full stack software engineering expertise.

GitHubLinkedIn
Resume
Email

Standing Rank

Rank Not Available

Developer Badges

Badges Pending

Skills & Technologies

38 skills
pythonjavascripttypescriptsqlreactnext.jsreact nativetailwind csshtmlcssui/ux designfigmanode.jsstrapifirebasesupabasemongodbpostgresqlsqlitegitgithubawsvercelnetlifydockerci/cd pipelinesqiskitpennylanecirqvqeqaoanisq algorithmsquantum circuit designerror mitigationdata structures & algorithmsobject-oriented designcomputer networksoperating systems

Work Experience

Software Debvelopment Intern

Blucypher

Apr 2026 - Present Not specified
  • Architected core modules for an AI-native security platform, designing a continuous discovery system to map external assets, shadow IT, and attack surfaces.
  • Integrated WeaverScan to aggregate vulnerability data across multiple tools, collaborating with security teams to build a unified, validated data schema.
  • Developed a Vulnerability Fusion Platform (VFP) scoring engine utilizing a 7 -factor risk assessment to orchestrate and track an 11-phase remediation workflow.

Software Engineer

Cryovault Biotech India

Jul 2025 - Mar 2026 Not specified
  • Sole developer for company website and customer portal; designed and delivered end -to-end solutions using Next.js, React, SQLite, and Strapi — demonstrating full software development lifecycle ownership.
  • Collaborated with stakeholders to gather requirements, translate needs into scalable technical solutions, and iterate based on feedback — mirroring cross-functional team collaboration.
  • Applied software engineering best practices including modular architecture, CI/CD deployment (Vercel), and responsive UI design, ensuring performance and scalability.
  • Designed intuitive user experiences with Figma design systems, bridging design and development workflows.

User Experience Design Intern

SYV Intelligent Systems Pvt Ltd.

May 2025 - Jun 2025 Not specified
  • Designed user-centric interfaces and workflows for web and mobile applications, improving usability and engagement through data-driven iteration.
  • Conducted usability testing and incorporated feedback into design revisions, demonstrating strong problem -solving and analytical skills.
  • Developed wireframes, high-fidelity prototypes using Figma, and streamlined design-to-development handoff reducing implementation ambiguity.

Frontend Developer & UI/UX Designer

VIT-AP University

Nov 2024 - May 2025 Not specified
  • Led a cross-functional team of developers and designers to build the VIT-AP University website using React and Next.js, ensuring responsive, accessible design.
  • Increased user engagement by 20% by redesigning navigation flows based on user research and iterative testing.
  • Managed end-to-end deployment on Vercel including domain setup and SSL configuration.

Projects

VEDHA – RL-Powered Drug Discovery & Virtual Simulator

PythonReinforcement LearningQuantum Computing (VQE)TypeScriptBERT
  • Architected a reinforcement learning environment (PatientDrugEnv) simulating multi -step treatment planning with a discrete action space of 20 candidate drugs and 5-step horizon — applied software engineering design to a complex AI system.
  • Encoded patient data into a 772-dimensional state vector combining BERT (bert-base-uncased) 768D embeddings with numerically extracted clinical indicators, demonstrating applied Python and ML engineering skills.
  • Designed reward shaping targeting physiological ranges (hemoglobin: 12 –16 g/dL; glucose: 70–110 mg/dL), enabling stable policy learning; validated via GuacaMol Benchmarks achieving a score of 8.6.
  • Built Proxima - a custom ML framework from scratch, demonstrating advanced software architecture and problem - solving capabilities.

VIT-AP University Careers Portal

View Project
Next.jsReactSQLiteTailwind CSSStrapiFigma
  • Developed a full-stack careers portal supporting CRUD operations and complex application workflows, demonstrating end-to-end software development skills valued in enterprise environments.
  • Participated in code review cycles and maintained clean, documented code throughout the development lifecycle.
  • Handled complete Vercel deployment including domain setup and SSL — equivalent to DevOps pipeline ownership.

VTBIF Technology Business Incubator Website

View Project
Next.jsReactFigma
  • Built a responsive, cross-browser-compatible website for a technology business incubator, optimizing performance and ensuring mobile responsiveness.
  • Designed wireframes and high-fidelity Figma prototypes prior to development, ensuring alignment with stakeholder requirements.

Leaderboard Standings

Leaderboard Position Pending

Global test scores, peer standing percentiles, and algorithm leaderboard ranks are updated dynamically.

Assessment Highlights

Assessments Not Completed

Coding evaluations, system assessment results, and conceptual score badges will appear here after taking a test.

AI Collaboration Score

AI Collaboration Score Pending

Developer coding behavior, assistant cooperation, and AI pair-programming indicators are evaluated during live coding sessions.

Role Compatibility Profile

Role Compatibility Analysis Pending

Custom matching reports, candidate role compatibility percentiles, and core engineer strength profiles are processed once conceptual code screenings are complete.

Achievements

Achievements Not Earned

Special rewards, developer badges, system recognition certificates, and conceptual milestones will display here.

About Details

Professional Bio

Motivated Computer Science undergraduate with strong software engineering fundamentals across the full stack. Proven ability to design and deliver end-to-end production applications and learn emerging technologies rapidly.

Bachelor of Technology in Computer Science Engineering

Vellore Institute of Technology – Andhra Pradesh (VIT-AP) (2023 - 2027)

Languages: English, Hindi
Email: Locked