App LogoApp name
PJ

pushpak jadhav

Open to work0 years experience

Software Developer

Pune, IndiaTarget Roles: Backend Engineer • Full-Stack Developer • Frontend Specialist

Software Developer specializing in MERN stack, LLM integration, and full-stack web development.

GitHubLinkedIn
Resume
Email

Standing Rank

Rank Not Available

Developer Badges

Badges Pending

Skills & Technologies

28 skills
c++pythonjavascripttypescriptsqlhtmlcssreact.jsnode.jsexpress.jsnext.jslangchainfastapimongooserediswebsocketsrestapigitgithubdockerkubernetespostgresqlprometheusgrafanamongodbmysqlawsjwt

Work Experience

Software Developer Intern

Namrata Groups

Oct 2025 - Dec 2025 Pune, India
  • Built a Full-stack HRIS Office Management System for Namrata Group, (Single-handedly), using the MERN stack, enabling HR, Directors, and Employees to access role-based dashboards for task assignment, deadline tracking, and performance monitoring, improving task visibility by 80% across departments
  • Automated payroll processing using ExcelJS, converting raw attendance data into final payroll sheets (leave balance, presence, delays, and deductions), reducing manual calculation effort by 85% and payroll processing time from 2-3 days to under 20-30 minutes.
  • Designed & Developed custom email system with labels like leave/ASAP, optimizing message categorization and lifting processing efficiency by 40%

Web Development - Freelance Website

Mrugakshi-Portfolio

May 2025 - Jun 2025 Pune, India
  • Designed and developed a modern portfolio website for Bollywood Art Director Mrugakshi Nadkarni using React.js, Tailwind CSS, and Framer Motion, aligning with her artistic brand and style.
  • Completed the project end-to-end as a freelance engagement, including UI design, client communication, feedback integration, Git-based collaboration, and deployment on Vercel with a custom Hostinger domain.

Projects

SheetPilot - Cursor for Excel

View Project
MERN StackLangChainExcelJSLLM IntegrationPrompt OrchestrationJWT AuthREST APIsRedis
  • A web platform that allows users to perform Excel operations using simple natural-language commands instead of formulas, automating analytics and spreadsheet workflows.
  • Built using the MERN stack with React state management, Express APIs, MongoDB data models, JWT authentication, REST architecture, and secure cloud deployment.
  • Integrated LLM-driven automation with prompt orchestration, function calling, formula/pivot generation, Excel processing logic, and an AI-first UI/UX with Framer Motion and workflow automation.

Real-Time Real-Life Banking & Investment Simulator

MERN StackJWT AuthenticationREST APIsMongoDBReact Dashboards
  • Engineered full-stack MERN financial simulation platform with React dashboards & Node.js computation engine, modeling real-world banking operations, investment flows, and networth calculations with MongoDB state.
  • Designed & managed external finance API integrations (Twelve Data, Finnhub) using secure API key handling, backend abstraction, rate-limit control, caching and data normalization for real-time & historical market data.
  • Developed a custom financial simulation engine to project future net worth by processing compound interest, loan amortization, and stock volatility, visualized through interactive Recharts data streams.

Leaderboard Standings

Leaderboard Position Pending

Global test scores, peer standing percentiles, and algorithm leaderboard ranks are updated dynamically.

Assessment Highlights

Assessments Not Completed

Coding evaluations, system assessment results, and conceptual score badges will appear here after taking a test.

AI Collaboration Score

AI Collaboration Score Pending

Developer coding behavior, assistant cooperation, and AI pair-programming indicators are evaluated during live coding sessions.

Role Compatibility Profile

Role Compatibility Analysis Pending

Custom matching reports, candidate role compatibility percentiles, and core engineer strength profiles are processed once conceptual code screenings are complete.

Achievements

LeetCode Knight

LeetCode: Knight- Rating 1867, Best Contest Rank: 1122 among 30,000 participants in a global contest.

CodeChef 3-Star Rating

CodeChef: 3-Star rating, Best rank 253 among div 3 participants, Secured Rank 1 in Rookie League in first contest.

CircuitVista Runner-up

Runner-up for AI-Enabled IoT Mocktail Maker project and also Nominated for government funding under the Yukti Innovation Program.

About Details

Professional Bio

Software Developer with expertise in MERN stack, LLM integration, and cloud technologies. Experienced in building full-stack applications, automating workflows, and developing financial simulation platforms. Passionate about system design and efficient software solutions.

Bachelor of Engineering in Electronics and Telecommunication

P.E.S Modern College of Engineering (2022 - 2026)

Languages: English, Hindi
Email: Locked